LiveZilla Live Help

Whois By J-SEO

Whois Domains Started With B :


braziliandesigns.net

braziliandesigns.net@contactprivacy.com

brazilprotests.com

brazilprotests.com@contactprivacy.com

break.chat

vzihc6cucae6@contactprivacy.email

breakcontactgear.com

breakcontactgear.com@contactprivacy.com

breaker19.chat

ij7rk7aqkbxr@contactprivacy.email

breakingnewsband.com

breakingnewsband.com@contactprivacy.com

breakoutkingston.com

melissa@improbableescapes.com

breandanmcdermott.com

29wgy5lwqard@contactprivacy.email

breastads.com

information@saskdiamonds.com

breathebnb.com

rachclem@gmail.com

brefugee.com

nyrve1ksbpc9@contactprivacy.email

brendadavislcsw.com

brendadavislcsw.com@contactprivacy.com

brennank.com

9quneoklkjmu@contactprivacy.email

brennantutoring.com

brennantutoring.com@contactprivacy.com

brentwoodsalescharlotte.com

kyxkkbvbevit@contactprivacy.email

brewmeister.net

jeffbezos.png@gmail.com

brewsteruniforms.com

brewsteruniforms.com@contactprivacy.com

brexitbullshit.com

brexitbullshit.com@contactprivacy.com

brexitdisaster.info

brexitdisaster.info@contactprivacy.com

brexitgear.com

brexitgear.com@contactprivacy.com

brexitleavewins.com

specmin@gmail.com

brexitresult.com

specmin@gmail.com

brexitrules.com

brexitrules.com@contactprivacy.com

brexitwin.com

specmin@gmail.com

briandavisjewellery.net

cdavisjewellery@cogeco.net

briandudley.site

bdudley@execulink.com

brianwhelanphoto.com

brianwhelanphoto.com@contactprivacy.com

bricolage.work

bricolage.work@contactprivacy.com

bridgetlapsley.com

bridgetlapsley.com@contactprivacy.com

brightclassroom.com

ldkarlsdmqr7@contactprivacy.email

brimarelectric.com

pmcallister76@gmail.com

brinktrippin.com

brinktrippin.com@contactprivacy.com

britainshine.com

britainshine.com@contactprivacy.com

britainshine.net

britainshine.net@contactprivacy.com

britbotlaw.com

britbotlaw.com@contactprivacy.com

brittanybrockway.com

wzyxxbsbccnt@contactprivacy.email

brittanyparker.org

brittanyparker.org@contactprivacy.com

brittanyparkerarchitect.com

brittanyparkerarchitect.com@contactprivacy.com

brittbottlaw.com

brittbottlaw.com@contactprivacy.com

brixandmortarwines.com

hodson.ben@me.com

broadbillenergy.com

domains@virtualdata.com

brockvilleescaperoom.com

melissa@improbableescapes.com

brokeyourapp.com

brokeyourapp.com@contactprivacy.com

brooklyncelttalksmediaarts.reviews

6cvwa6lam1be@contactprivacy.email

brookswoodmusic.com

dturi@sd35.bc.ca

brownlavalley.com

brownlavalley.com@contactprivacy.com

brownsbridgeparents.com

brownsbridgeparents.com@contactprivacy.com

brownscraft.com

sp5cqpok0aoi@contactprivacy.email

brownsicebox.com

ssmith@alignsoft.com

browsbybianca.com

browsbybianca.com@contactprivacy.com

brozechoes.com

peter@universitytel.ca

brozechoesmusic.com

peter@universitytel.ca

brucestewartmd.com

wtamir@gmail.com

bruhxit.com

bruhxit.com@contactprivacy.com

brutalcut.com

brutalcut.com@contactprivacy.com

bryceconnormassage.com

bryceconnormassage.com@contactprivacy.com

bsafe2night.com

bsafe2night.com@contactprivacy.com

bsafe2night.org

bsafe2night.org@contactprivacy.com

bsl78.com

bsl78.com@contactprivacy.com

bsmg-global.com

bsmg-global.com@contactprivacy.com

bthomascomedy.com

bthomascomedy.com@contactprivacy.com

bubbasroadhousesodus.com

bubbasroadhousesodus.com@contactprivacy.com

bucketmouthmedia.com

tylerbhawley@gmail.com

buckeyehelpdeskservices.com

cw3u92orcjbe@contactprivacy.email

buckheadparents.com

buckheadparents.com@contactprivacy.com

buddforpalmbeach.com

ajlloxmdseny@contactprivacy.email

buddforstatecommitteeman.com

ro01wtrarwwm@contactprivacy.email

budgetroofinghsv.com

budgetroofinghsv.com@contactprivacy.com

bugouthemovie.com

advancein@shaw.ca

buildingbetterbritain.com

buildingbetterbritain.com@contactprivacy.com

buildingtopteams.info

visioneer08@gmail.com

buildingvaluetoyou.com

a7bw4teuehoq@contactprivacy.email

bukkyjohn.com

wa8pnc6i2j1el1g79g@domain-shield.com

bumerlab.com

bumerlab.com@contactprivacy.com

bumpetybumpartmachines.com

bumpetybumpartmachines.com@contactprivacy.com

bungalowsofforestheights.com

royerd@hotmail.com

buntmagazine.com

1zf1jv0yrvyz@contactprivacy.email

buquebusrecoleta.com

buquebusrecoleta.com@contactprivacy.com

burgercentral.com

ray@kingweb.com

burgercreative.com

5bhvjjsr5qkg@contactprivacy.email

burguerbeer.online

burguerbeer.online@promoprivacy.com

burkettsbriquettes.com

burkettsbriquettes.com@contactprivacy.com

burningriverbasketcompany.com

burningriverbasketcompany.com@contactprivacy.com

burodevenezuela.com

derekiwasiuk@gmail.com

burrardviewcoop.org

burrardviewcoop.org@contactprivacy.com

businesscarddesigndurhamregion.com

graphic.services4u@gmail.com

businesscomplianceservices.com

businesscomplianceservices.com@contactprivacy.com

businessmindartistheart.com

businessmindartistheart.com@contactprivacy.com

businessmindengineer.com

cfpnkhcff3dp@contactprivacy.email

businessrankxl.com

businessrankxl.com@contactprivacy.com

businessstart-up.live

sandra@omega5.ca

busyalmosteverydate.com

busyalmosteverydate.com@contactprivacy.com

busyhr.com

64cmuqkegxxm@contactprivacy.email

butchslaughter.biz

butchslaughter.biz@contactprivacy.com

butikodam.com

butikodam.com@contactprivacy.com

butterfielddentist.com

butterfielddentist.com@registrantprivacy.com

buyamericainvestors.com

buyamericainvestors.com@contactprivacy.com

buyamtextiles.com

buyamtextiles.com@contactprivacy.com

buyandsellinscugog.com

dresselnancy@gmail.com

buyantisocial.com

buyantisocial.com@contactprivacy.com

buyevergreenstatesurplus.com

buyevergreenstatesurplus.com@contactprivacy.com

buyinscugog.com

dresselnancy@gmail.com

buymytdi.com

qqdntzf4rbeu@contactprivacy.email

buyrockdirect.com

wim5w3v4pzlg@contactprivacy.email

bye.email

goit26v7hptx@contactprivacy.email

byelgium.com

byelgium.com@contactprivacy.com

byjosette.com

byjosette.com@contactprivacy.com

bymanon.com

britenusa@yahoo.ca

byronduvall.com

for84zctywky@contactprivacy.email

bytheeglass.com

bytheeglass.com@contactprivacy.com

bywayofmotorcycle.net

bywayofmotorcycle.net@contactprivacy.com

barracudaappart.com

monachrisbarracuda@gmail.com

biosferaamordodia.com

biosferaamordodia@gmail.com

boomtv-gest.com

heltonvipc@gmail.com

babybabbelengetrouwd.xyz

2627153@privacy-link.com

beloved.black

2626848@privacy-link.com

bernardinagonales.xyz

2626911@privacy-link.com

Showing 371881 to 372000 of 487874 (4066 Pages)